Buy 95% purity IGF-1 LR3 peptide online today at Peptides UK. All peptides provided by Peptides UK are intended for research purposes only. We offer UK and worldwide fast and reliable shipping services. Our peptides are manufactured at a cGMP and ISO9001 compliant and certified laboratory. Our IGF-1 peptide product is the highest grade and quality on the market today. All peptides are sold for research and in vitro studies only. To avoid contamination, degradation, and oxidation, the peptide must be stored correctly in controlled conditions. Once you have received your peptides, they are stable at room temperature for up to 2 months once not reconstituted, but it is recommended that they are stored in refrigeration.
Peptides UK is a truly unique peptide online store offering high quality and high purity peptides, setting a new standard in the industry. All our products are tested for purity by MS-U PLC and HPLC. We offer the most competitive prices on the market for premium quality peptides. We offer combo packages at discounted prices which are created to suit all your research needs.
- Product Name: IGF LR3 1mg
- Molecular Weight: 9117.60 gmol
- Purity: ≥98%
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Form: Lyophilised Solid
Long arginine 3-IGF-1 (IGF-1 LR3), available in a 1mg quantity, is a premium research peptide designed for advanced scientific studies in biochemistry and related disciplines. This product is perfect for laboratory environments that require high levels of precision and reliability.
IGF-1 LR3 Storage and Usage
IGF-1 LR3 1mg comes in lyophilized form for optimal stability and convenient use in research settings.
For optimal outcomes, please adhere to the comprehensive reconstitution instructions and storage instructions provided on our website.
Peptides UK Products are sold strictly for research purposes only. Please do not ask about human consumption as this is forbidden
Specification
PHYSICAL AND CHEMICAL PROPERTIES
IGF-1 Long R3 (Insulin-like Growth Factor 1)
1mg per vial
Product Name: IGF-1 LR3
Unit Size: 1mg per vial
CAS No: 946870-92-4
Synomyms: Long R3 IGF-1, Insulin-Like Growth Factor-I LR3
Sequence: H-Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-S
Molecular Formula: C990/H1528/N262/O300/S7
Purity: >95%
Physical State: Lyophilized Powder
Storage: Although lyophilized peptides are stable at room temperature for up to 2 months, they should be stored desiccated below -18°C. On reconstitution, the peptide should then be stored at 4°C


