TB500 5mg

Our TB500 5mg is strictly manufactured in a fully certified laboratory that is cGMP and IS09001 compliant. This research product is for sale for the strict use in in-vitro research only. At PeptidesUK you are always guaranteed a purity of >98% from all our listed peptides.

Our peptide vials are safely stored in a fully monitored and temperature controlled system which maintains high-quality and purity. TB500 (Thymosin Beta 4) is also strictly tested for purity by HPLC and MS-UPLC analysis. You can always contact us for discounts on bulk orders. Safely shipped from the UK via fast and reliable shipping services.

• Peptide Name: TB500 5mg
• Molecular Formula: C212/H350/N56/O78/S
• Molecular Weight: 4963.4 g/mol
• Purity: 98%
• Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
• Form: Lyophilised Solid

TB-500, available in a 5mg formulation, stands as a top-quality, specialized research peptide meticulously crafted for cutting-edge scientific investigation into cellular rejuvenation and tissue restoration.

TB500 Storage and Usage

TB500 comes in lyophilized form for optimal stability and convenient use in research settings.

For optimal outcomes, adhere to the comprehensive reconstitution instructions and storage instructions provided on our website.

Peptides UK Products are sold strictly for research purposes only. Please do not ask about human consumption as this is forbidden

• Product Name: Thymosin Beta 4
• Molecular Formula: C212/H350/N56/O78S
• Molecular Weight:
• Purity: >98%
• Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
• Form: Lyophilised Solid